>1xu2_B mol:protein length:138  Tumor necrosis factor ligand superfamily member 13
KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLF
HDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIP
RANAKLSLSPHGTFLGFVKL