>1xuq_A mol:protein length:212  Superoxide dismutase
GSSHHHHHHMAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAEL
ADKSVEELVANLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAK
FGSFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWE
HAYYLNYQNRRPDYIGAFWNVVDWNAAEKRYQEAK