>1xz9_A mol:protein length:101  Afadin
GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAA
GDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIY
>1xz9_A mol:protein length:101  Afadin
GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAA
GDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIY