>1y67_A mol:protein length:229  Manganese Superoxide dismutase
MAAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQ
QLDRVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDA
FKQKFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWE
HAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYAAAKLVPRGSAAALEHHHHHH