>1ye2_D mol:protein length:146  Hemoglobin beta chain
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVFPWTQRFFESFGDLSTPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF
GKEFTPPVQAAYQKVVAGVANALAHKYH