>1yee_H mol:protein length:222  IGG2A FAB FRAGMENT (D2.5)
EVKLQESGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRAAAGLEWIARIYPGTGSSY
YNVKFKGKATLTADKSSSTAYMQLSSLKSDDSAVYFCVRWGFIPVREDYVLDYWGQGTL
VTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFP
AVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
>1yee_H mol:protein length:222  IGG2A FAB FRAGMENT (D2.5)
EVKLQESGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRAAAGLEWIARIYPGTGSSY
YNVKFKGKATLTADKSSSTAYMQLSSLKSDDSAVYFCVRWGFIPVREDYVLDYWGQGTL
VTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFP
AVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
>1yee_L mol:protein length:219  IGG2A FAB FRAGMENT (D2.5)
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLSWLLQRPGQSPKRLIYLVSKL
DSGVPDRFTGSGSGTDFTLKISRVEAADLGLYYCVQGTHFPYTFGGGTKLEILRADAAP
TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST
YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC