>1yi2_1 mol:protein length:57  50S ribosomal protein L37e
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE