>1yi2_G mol:protein length:348  ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG
MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAEL
RVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGE
VAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLSDSTVLDTGEEVSQELSN
VLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYP
TATTAPTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEEL
QGVEADVATEEPTDDQDDDTASEDDADADDAAEEADDDDDDDEDAGDALGAMF