>1yi2_N mol:protein length:187  50S ribosomal protein L18P
MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTL
ASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFA
IQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELR
ETLLDGDIEL