>1yi2_R mol:protein length:155  50S ribosomal protein L22P
MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVP
FKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAH
KVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED