>1yi2_S mol:protein length:85  50S ribosomal protein L23P
MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTM
DGEKKAVVRLSEDDDAQEVASRIGVF