>1yi2_W mol:protein length:154  50S ribosomal protein L30P
MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQ
ETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRL
HPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR