>1yit_1 mol:protein length:57  50S RIBOSOMAL PROTEIN L37E
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE