>1yit_J mol:protein length:145  50S RIBOSOMAL PROTEIN L13P
MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEK
RVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDG
TSLDRLSNIKFVTLGEISETLGANKTW