>1yit_Q mol:protein length:96  50S RIBOSOMAL PROTEIN L21E
MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDG
QTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE