>1yit_R mol:protein length:155  50S RIBOSOMAL PROTEIN L22P
MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVP
FKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAH
KVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED