>1yit_Z mol:protein length:83  50S RIBOSOMAL PROTEIN L37AE
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGS
YKPETPGGKTVRRSIRAALSEDEE