>1zij_A mol:protein length:34  GENERAL CONTROL PROTEIN GCN4
XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER