>1zij_B mol:protein length:34  GENERAL CONTROL PROTEIN GCN4
XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER