>2a1a_B mol:protein length:284  Interferon-induced, double-stranded RNA-activated protein kinase
GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALA
KLDHVNIVHYNGCWDGFDYDPETSSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEK
LDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGK
RTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGII
SDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTA