>2a4x_B mol:protein length:138  Mitomycin-Binding Protein
MSARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRS
YDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDP
DGNVVDLFAPLPLEHHHHHH
>2a4x_A mol:protein length:138  Mitomycin-Binding Protein
MSARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRS
YDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDP
DGNVVDLFAPLPLEHHHHHH
>2a4x_B mol:protein length:138  Mitomycin-Binding Protein
MSARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRS
YDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDP
DGNVVDLFAPLPLEHHHHHH