>2ain_A mol:protein length:93  Afadin
MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLS
VDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGA
>2ain_B mol:protein length:6  6-mer peptide from Breakpoint cluster region protein
LFSTEV
>2ain_B mol:protein length:6  6-mer peptide from Breakpoint cluster region protein
LFSTEV