>2axt_M mol:protein length:36  Photosystem II reaction center M protein
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS