>2axt_j mol:protein length:40  Photosystem II reaction center J protein
MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL