>2az0_B mol:protein length:73  B2 protein
MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSL
LEKPSVVAYLEGKA