>2b2t_C mol:protein length:115  Chromodomain-helicase-DNA-binding protein 1
MKKHHHHHHEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQ
YLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEY