>2b9z_B mol:protein length:74  B2 protein
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVT
SLLEKPSVVAYLEGK
>2b9z_B mol:protein length:74  B2 protein
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVT
SLLEKPSVVAYLEGK
>2b9z_A mol:protein length:74  B2 protein
GAMPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVGRMVT
SLLEKPSVVAYLEGK