>2bbm_B mol:protein length:26  MYOSIN LIGHT CHAIN KINASE
KRRWKKNFIAVSAANRFKKISSSGAL
>2bbm_B mol:protein length:26  MYOSIN LIGHT CHAIN KINASE
KRRWKKNFIAVSAANRFKKISSSGAL
>2bbm_A mol:protein length:148  CALMODULIN
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTD
EEVDEMIREADIDGDGQVNYEEFVTMMTSK