>2bg9_B mol:protein length:370  ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN
SVMEDTLLSVLFENYNPKVRPSQTVGDKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLA
WTDYRLQWDPAAYEGIKDLSIPSDDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSW
HPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVILQHALDAMINQDAFTENGQW
SIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIVPCILISILAILVFYLPPDA
GEKMSLSISALLALTVFLLLLADKVPETSLSVPIIISYLMFIMILVAFSVILSVVVLNL
HHRSPNTHEAVEAIKYIAEQLESASEFDDLKKDWQYVAMVADRLFLYIFITMCSIGTFS
IFLDASHNVPPDNPFA