>2bti_B mol:protein length:63  CARBON STORAGE REGULATOR HOMOLOG
GSMLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQ
PTSY