>2c60_A mol:protein length:111  HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFORM 2
MHHHHHHSSGVDLGTENLYFQSMGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHK
VTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQD
>2c60_A mol:protein length:111  HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFORM 2
MHHHHHHSSGVDLGTENLYFQSMGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHK
VTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQD