>2cd0_B mol:protein length:111  PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN)
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGV
PDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
>2cd0_A mol:protein length:111  PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN)
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGV
PDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
>2cd0_B mol:protein length:111  PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN)
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGV
PDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG