>2ce6_A mol:protein length:101  HELIX POMATIA AGGLUTININ
RVQSGKINCGDDAGWAKVPSNDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQS
QNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIENY
>2ce6_A mol:protein length:101  HELIX POMATIA AGGLUTININ
RVQSGKINCGDDAGWAKVPSNDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQS
QNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIENY