>2cjx_A mol:protein length:147  CASPASE-3
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRN
KNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGD
RCRSLTGKPKLFIIQACRGTELDCGIETD