>2cjx_B mol:protein length:103  CASPASE-3
ASGVADDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFM
HILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH