>2ck0_H mol:protein length:219  PROTEIN (IMMUNOGLOBULIN; HEAVY CHAIN)
QVQLQESGGGLVQPRGSLKLSCAASGFTFNTDAMNWVRQAPGKGLEWVARIRSKGFNFA
TYYADSVRDRFTISRDDSQSMLYLQMNNLKTEDTGIYYCVRGRDGEAMDYWGQGTTLTV
SSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVL
QSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVN