>2ck0_L mol:protein length:216  PROTEIN (IMMUNOGLOBULIN; LIGHT CHAIN)
DIQLTQSPSSLAVSAGEKVTMNCKSSQNLLHSITRKNYLAWYRQKPGQSPKLLIYWAST
RGSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAP
TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST
YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR