>2cok_A mol:protein length:113  Poly [ADP-ribose] polymerase-1
GSSGSSGDKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEK
MNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSSWGAEVKSGPSSG
>2cok_A mol:protein length:113  Poly [ADP-ribose] polymerase-1
GSSGSSGDKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEK
MNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSSWGAEVKSGPSSG