>2cor_A mol:protein length:79  PINCH protein
GSSGSSGEKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELK
GELYCLPCHDKMGVSGPSSG