>2cp2_A mol:protein length:95  CLIP-115
GSSGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGK
NDGAVGGVRYFECPALQGIFTRPSKLTRQPSGPSSG
>2cp2_A mol:protein length:95  CLIP-115
GSSGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGK
NDGAVGGVRYFECPALQGIFTRPSKLTRQPSGPSSG