>2cp3_A mol:protein length:84  CLIP-115
GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYF
QCPPKFGLFAPIHKVIRIGSGPSSG
>2cp3_A mol:protein length:84  CLIP-115
GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYF
QCPPKFGLFAPIHKVIRIGSGPSSG