>2cra_A mol:protein length:70  Homeobox protein Hox-B13
GSSGSSGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRR
VKEKKSGPSSG
>2cra_A mol:protein length:70  Homeobox protein Hox-B13
GSSGSSGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRR
VKEKKSGPSSG