>2cw9_A mol:protein length:194  translocase of inner mitochondrial membrane
GSSGSSGDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLK
QCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVD
LAMGKMVEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPY
AAWRLLDISASSTEQIL
>2cw9_A mol:protein length:194  translocase of inner mitochondrial membrane
GSSGSSGDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLK
QCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVD
LAMGKMVEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPY
AAWRLLDISASSTEQIL