>2czy_A mol:protein length:77  Paired amphipathic helix protein Sin3b
PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDL
IVGFNAFLPLGYRIDIPK
>2czy_B mol:protein length:15  transcription factor REST (version 3)
APQLIMLANVALTGE
>2czy_B mol:protein length:15  transcription factor REST (version 3)
APQLIMLANVALTGE