>2d68_B mol:protein length:82  FOP
KTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLAR
DLGIIEAEGTVGGPLLLEVIRRW