>2d99_A mol:protein length:90  General transcription factor II-I repeat domain-containing protein 1
GSSGSSGLRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPA
EYDPKALMAILEHSHRIRFKLKRPSSGPSSG
>2d99_A mol:protein length:90  General transcription factor II-I repeat domain-containing protein 1
GSSGSSGLRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPA
EYDPKALMAILEHSHRIRFKLKRPSSGPSSG