>2dk6_A mol:protein length:102  PARP11 protein
GSSGSSGNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCG
SISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSSGPSSG
>2dk6_A mol:protein length:102  PARP11 protein
GSSGSSGNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCG
SISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSSGPSSG