>2dmz_A mol:protein length:129  InaD-like protein
GSSGSSGGSDSSLFETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSVIPGSAA
YHNGHIQVNDKIVAVDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPS
DRGTVSGPSSG