>2dre_B mol:protein length:180  Water-soluble chlorophyll protein
INDEEPVKDTNGNPLKIETRYFIQPASDNNGGGLVPANVDLSHLCPLGIVRTSLPYQPG
LPVTISTPSSSEGNDVLTNTNIAITFDAPIWLCPSSKTWTVDSSSEEKYIITGGDPKSG
ESFFRIEKYGNGKNTYKLVRYDNGEGKSVGSTKSLWGPALVLNDDDDSDENAFPIKFRE
VDT