>2e1o_A mol:protein length:70  Homeobox protein PRH
GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRR
AKWRRSGPSSG